• Peptidy prodej cena v České
  • Peptiden kopen prijs Nederland
  • Acquista pepitidi prezzo Italie
  • Comprar péptidos precio España
  • Peptide kaufen preis Deutschland
  • Peptides achat prix France

RegisterSign In

PeptidesHGH

Peptide Follistatin 1mg for sale in UK

 
Request a call back / SMS

Sending a message

Testimonials

You can write a review about the store after the purchase!
Your Shopping cart
Purchase Follistatin 1mg in the UK - Highest quality, Best Price.

Follistatin (FST-344) 1mg

  • Testimonials

    0

  • User rating

    23

  • 3.91
  • 3.91

OLD PRICE: £84
£ 4995 (YOU SAVE: £34)

Purchase

It is the strongest Myostatin inhibitor. As a result it increases your muscle weight and strength results.

Physical and chemical properties
CAS Number 80449-31-6
PubChem CID 16132341
Molecular mass 37800
Sequence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptide purity >85%
Solubility Soluble in water - 100 μg/mL sterile diluent (distilled de-ionized water)
Physical appearance White Lyophilized Powder
Source Biosynthetic production (Chemical Synthesis)
Terms The products we offer are intended for laboratory research use only. Please familiarize yourself with our Terms and conditions prior to ordering.
Synonyms FST-344
Unit Size 1 mg/vial
Unit quantity 1 vial
Additional information
Half life
Storage Lyophilized Follistatin is stable at room temperature for 90 days, however it should be stored in a freezer below -8°C for any extended period of time. After reconstituting Follistatin should be refrigerated at temperatures not to exceed 2°C.
Compatibility All Products
WARNING This product is a lyophilized peptide for research use only. This product is NOT for human use.
Customers who bought this item also bought:

Customer reviews

Read more: - 0