PeptidesHGH

Peptidi Follistatin netistä Suomi

 
Pyydä puhelua / SMS

Sending a message

Mielipiteita

Voit kirjoittaa uudelleen noin myymälä oston jälkeen!
Ostoskärrysi
Osta Follistatin 1mg Suomessa, paras hinta. Tilaa Follistatin 1mg Netistä.

Follistatin (FST-344) 1mg

  • Suosittelut

    0

  • Käyttäjäarvostelu

    34

  • 4.44
  • 4.44

VANHA HINTA: 100 €
€ 5995 (SÄÄSTÄT: 40 €)

OSTA NYT

Se antaa hyviä tuloksia lihaksen kasvua ja lisätä voimaa. Ei havaittu doping valvonta. Ehkä punoitus injektiokohdassa. Se suositellaan miehille

Fysikaaliset ja kemialliset ominaisuudet
CAS-numero 80449-31-6
PubChem CID 16132341
Molekyylipaino 37800
Sequence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Peptidin puhtaus >85%
Liukoisuus Liukenee veteen - 100 μg/mL steriiliä laimenninta (tislattua deionisoitua vettä)
Fyysinen ulkonäkö Valkoinen lyofilisoitu jauhe
Lähde Biosynteettinen tuotanto (Chemical Synthesis)
Ehdot Tarjoamamme tuotteet on tarkoitettu vain laboratoriotutkimukseen. Tutustu Käyttöehtojamme ennen tilaamista.
Synonyymit FST-344
Yksikkökoko 1 mg/vial
Yksikkömäärä 1 vial
Lisätiedot
Puoliintumisaika
Säilytys Lyophilized Follistatin on stabiili huoneenlämpötilassa 90 päivää, mutta se on säilytettävä pakastimessa alle -8°C: n lämpötilassa pidemmän aikaa. Follistatinin käyttövalmiiksi saattamisen jälkeen jääkaapissa on oltava enintään 2°C: n lämpötiloissa.
Yhteensopivuus Kaikki tuotteet
VAROITUS Tämä tuote on lyofilisoitu peptidi vain tutkimuskäyttöön. Tämä tuote EI ole ihmisen käyttöön.
Asiakkaat jotka ostivat tämän tuotteen, ostivat myös:

Asiakkaiden arvostelut

Lue lisää arvosteluja tästä tuotteesta

Muut kielet English