PeptidesHGH

Peptide Follistatin Hungary

 
Request a call back / SMS

Sending a message

Reviews

You can write a review about the store after the purchase!
Your Shopping cart
Buy Follistatin 1mg in Europe, best price. Order Follistatin 1mg online now.

Follistatin (FST-344) 1mg

  • Testimonials

    0

  • User rating

    34

  • 4.44
  • 4.44

OLD PRICE: Ft42218
Ft25331 (YOU SAVE: Ft16887)

Buy

It is the strongest Myostatin inhibitor. As a result, it increases your muscle weight and strength results.

Physical and chemical properties
CAS Number 80449-31-6
PubChem CID 16132341
Molecular mass 37800
Sequence GNCWLRQAKNGRCQV LYKTELSKEECCSTGRLS TSWTEEDVNDNTLFKWMIFNGGAP NCIPCKETCENVDCGPGKKCRMNKKNKPR CVCAPDCSNITWKGPVCGLDGKTY RNECALLKARCKEQPELEVQYQGRCKKT CRDVFCPGSSTCVVDQTNNAYCV TCNRICPEPASSEQYLCGN DGVTYSSACHLRKATCLLGRSIGLAYEGKCI KAKSCEDIQCTGGKKCLWDFKV GRGRCSLCDELCPDSKSDEPVCASDNATYASE CAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Purity of peptide >85%
Solubility Soluble in water - 100 μg/mL sterile diluent (distilled de-ionized water)
Physical appearance White Lyophilized Powder
Source Biosynthetic production (Chemical Synthesis)
Terms The products we offer are intended for laboratory research use only. Please familiarize yourself with our Terms and conditions prior to ordering.
Synonyms FST-344
Unit Size 1 mg/vial
Unit quantity 1 vial
Additional information
Half life
Storage Lyophilized Follistatin is stable at room temperature for 90 days, however it should be stored in a freezer below -8°C for any extended period of time. After reconstituting Follistatin should be refrigerated at temperatures not to exceed 2°C.
Compatibility All Products
WARNING This product is a lyophilized peptide for research use only. This product is NOT for human use.
Customers who bought this item also bought:

Customer reviews

Read more reviews about this product

Other languages Magyar
Other countries 0 customer reviews